PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00078803001
Common NameGSBRNA2T00078803001, LOC106361187
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family G2-like
Protein Properties Length: 397aa    MW: 43731.3 Da    PI: 6.0614
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00078803001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1054.4e-33209263155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          k+r+rWtpeLHe+Fveav++LGGs++AtPk +l+ mkv+gLt++hvkSHLQkYR+
  GSBRNA2T00078803001 209 KARMRWTPELHEAFVEAVNSLGGSDRATPKGVLKKMKVEGLTIYHVKSHLQKYRT 263
                          68****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.153206266IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.1E-30207265IPR009057Homeodomain-like
SuperFamilySSF466895.2E-17208263IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-24209263IPR006447Myb domain, plants
PfamPF002491.1E-9211262IPR001005SANT/Myb domain
PfamPF143792.6E-24297340IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 397 aa     Download sequence    Send to blast
MEARPVQRSG SRELSNLART SSIPSTPNPS SAPEAAFMRP DHKPLGQQTY HLLSSSNGGS  60
VGHICSSSSS GFSTNLHYSS MEKHYAAASS NDDSSWCNGG FLDFPEDHQA VHNNSQIEDG  120
CIGIGAGFDD IQKPNDWQWA DHLITDEDPL LSTNWNDLLI DTSSNSDTKD QKSLQPIPPQ  180
SQTVQQQPSP SVSVELRPVS TTSSNSNNKA RMRWTPELHE AFVEAVNSLG GSDRATPKGV  240
LKKMKVEGLT IYHVKSHLQK YRTARYRPEP SESGSPEKKL TPLEHITALD LKGGIGITEA  300
LRLQMEVQKQ LHEQLEIQRN LQLRIEEQGK YLQMMFEKQN SGLGKGKGTA STSDSPSKSE  360
QEDNKKTADS EELAPEETRK CQEPESPQPK RVKTDN*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.256500.0flower
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00078803001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013656353.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
RefseqXP_009109073.10.0PREDICTED: protein PHR1-LIKE 1-like isoform X1
SwissprotQ8GUN55e-73PHL1_ARATH; Protein PHR1-LIKE 1
TrEMBLA0A078FM900.0A0A078FM90_BRANA; BnaA08g13620D protein
TrEMBLM4D1K50.0M4D1K5_BRARP; Uncharacterized protein
STRINGBra010355.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM85627117
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.10.0phosphate starvation response 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]